Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,021
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,922
  3. Avatar for SARE/BRBT 2021 13. SARE/BRBT 2021 1 pt. 9,592
  4. Avatar for test_group1 14. test_group1 1 pt. 3,796
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 3,796
  1. Avatar for BootsMcGraw 41. BootsMcGraw Lv 1 16 pts. 10,419
  2. Avatar for akaaka 42. akaaka Lv 1 15 pts. 10,404
  3. Avatar for zackallen 43. zackallen Lv 1 14 pts. 10,399
  4. Avatar for Crossed Sticks 44. Crossed Sticks Lv 1 13 pts. 10,385
  5. Avatar for Zosa 45. Zosa Lv 1 13 pts. 10,384
  6. Avatar for Lotus23 46. Lotus23 Lv 1 12 pts. 10,350
  7. Avatar for BLU2117 47. BLU2117 Lv 1 11 pts. 10,342
  8. Avatar for blazegeek 48. blazegeek Lv 1 11 pts. 10,341
  9. Avatar for Deleted player 49. Deleted player 10 pts. 10,333
  10. Avatar for MirsadaH 50. MirsadaH Lv 1 9 pts. 10,311

Comments