Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,021
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,922
  3. Avatar for SARE/BRBT 2021 13. SARE/BRBT 2021 1 pt. 9,592
  4. Avatar for test_group1 14. test_group1 1 pt. 3,796
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 3,796
  1. Avatar for xbp 81. xbp Lv 1 1 pt. 10,077
  2. Avatar for hada 82. hada Lv 1 1 pt. 10,067
  3. Avatar for rakvium 83. rakvium Lv 1 1 pt. 10,066
  4. Avatar for Larini 84. Larini Lv 1 1 pt. 10,042
  5. Avatar for dahast.de 85. dahast.de Lv 1 1 pt. 10,021
  6. Avatar for Beany 86. Beany Lv 1 1 pt. 10,015
  7. Avatar for borattt 87. borattt Lv 1 1 pt. 9,970
  8. Avatar for Dr.Sillem 88. Dr.Sillem Lv 1 1 pt. 9,943
  9. Avatar for Altercomp 89. Altercomp Lv 1 1 pt. 9,942
  10. Avatar for ShadowTactics 90. ShadowTactics Lv 1 1 pt. 9,922

Comments