Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,454
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,853
  3. Avatar for Team China 13. Team China 1 pt. 9,277
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,292
  2. Avatar for phi16 2. phi16 Lv 1 71 pts. 11,243
  3. Avatar for toshiue 3. toshiue Lv 1 49 pts. 11,219
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 33 pts. 11,216
  5. Avatar for mirp 5. mirp Lv 1 22 pts. 11,215
  6. Avatar for kyoota 6. kyoota Lv 1 14 pts. 11,209
  7. Avatar for silent gene 7. silent gene Lv 1 8 pts. 11,208
  8. Avatar for LociOiling 8. LociOiling Lv 1 5 pts. 11,205
  9. Avatar for Maerlyn138 9. Maerlyn138 Lv 1 3 pts. 11,195
  10. Avatar for fpc 10. fpc Lv 1 2 pts. 11,166

Comments