Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since almost 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,292
  2. Avatar for Go Science 2. Go Science 65 pts. 11,219
  3. Avatar for Beta Folders 3. Beta Folders 41 pts. 11,208
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 11,166
  5. Avatar for Contenders 5. Contenders 14 pts. 11,144
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 10,932
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 10,811
  8. Avatar for Australia 8. Australia 2 pts. 10,751
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,697
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,654

  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 11,263
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 97 pts. 11,214
  3. Avatar for LociOiling 3. LociOiling Lv 1 93 pts. 11,208
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 89 pts. 11,203
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 86 pts. 11,190
  6. Avatar for Aubade01 6. Aubade01 Lv 1 82 pts. 11,173
  7. Avatar for sallallami 7. sallallami Lv 1 79 pts. 11,168
  8. Avatar for johnmitch 8. johnmitch Lv 1 76 pts. 11,168
  9. Avatar for Galaxie 9. Galaxie Lv 1 73 pts. 11,163
  10. Avatar for Phyx 10. Phyx Lv 1 70 pts. 11,158

Comments