Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,454
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,853
  3. Avatar for Team China 13. Team China 1 pt. 9,277
  1. Avatar for Savas 91. Savas Lv 1 1 pt. 9,853
  2. Avatar for lacarpe59 92. lacarpe59 Lv 1 1 pt. 9,835
  3. Avatar for Museka 93. Museka Lv 1 1 pt. 9,810
  4. Avatar for Zosa 94. Zosa Lv 1 1 pt. 9,806
  5. Avatar for Altercomp 95. Altercomp Lv 1 1 pt. 9,734
  6. Avatar for Mohoernchen 96. Mohoernchen Lv 1 1 pt. 9,729
  7. Avatar for Marlon Boni 97. Marlon Boni Lv 1 1 pt. 9,711
  8. Avatar for frostschutz 98. frostschutz Lv 1 1 pt. 9,703
  9. Avatar for Visok 99. Visok Lv 1 1 pt. 9,690
  10. Avatar for Clunkydunky 100. Clunkydunky Lv 1 1 pt. 9,660

Comments