Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,454
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,853
  3. Avatar for Team China 13. Team China 1 pt. 9,277
  1. Avatar for misterben64 111. misterben64 Lv 1 1 pt. 9,280
  2. Avatar for zo3xiaJonWeinberg 112. zo3xiaJonWeinberg Lv 1 1 pt. 9,277
  3. Avatar for ddickerson 113. ddickerson Lv 1 1 pt. 9,257
  4. Avatar for Giantbluefish 114. Giantbluefish Lv 1 1 pt. 9,222
  5. Avatar for altejoh 115. altejoh Lv 1 1 pt. 9,221
  6. Avatar for proteins_go_brrr 116. proteins_go_brrr Lv 1 1 pt. 9,200
  7. Avatar for CXFG 117. CXFG Lv 1 1 pt. 8,779
  8. Avatar for AeonFluff 118. AeonFluff Lv 1 1 pt. 8,703
  9. Avatar for chlorowolf 119. chlorowolf Lv 1 1 pt. 8,461
  10. Avatar for harvardman 120. harvardman Lv 1 1 pt. 8,437

Comments