Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,454
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,853
  3. Avatar for Team China 13. Team China 1 pt. 9,277
  1. Avatar for 1hana 121. 1hana Lv 1 1 pt. 7,986
  2. Avatar for FelipeSMA 122. FelipeSMA Lv 1 1 pt. 7,269
  3. Avatar for ALEXIS.E 123. ALEXIS.E Lv 1 1 pt. 7,255
  4. Avatar for Unryz 124. Unryz Lv 1 1 pt. 7,237
  5. Avatar for ManVsYard 125. ManVsYard Lv 1 1 pt. 7,139
  6. Avatar for furi0us 126. furi0us Lv 1 1 pt. 6,983
  7. Avatar for Bletchley Park 127. Bletchley Park Lv 1 1 pt. 6,983
  8. Avatar for milkshake 128. milkshake Lv 1 1 pt. 6,983
  9. Avatar for spvincent 129. spvincent Lv 1 1 pt. 6,983

Comments