Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,454
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,853
  3. Avatar for Team China 13. Team China 1 pt. 9,277

  1. Avatar for Deleted player 41. Deleted player 16 pts. 10,695
  2. Avatar for zippyc137 42. zippyc137 Lv 1 15 pts. 10,691
  3. Avatar for Wiz kid 43. Wiz kid Lv 1 14 pts. 10,687
  4. Avatar for bamh 44. bamh Lv 1 13 pts. 10,675
  5. Avatar for TheGUmmer 45. TheGUmmer Lv 1 13 pts. 10,654
  6. Avatar for Crossed Sticks 46. Crossed Sticks Lv 1 12 pts. 10,651
  7. Avatar for drjr 47. drjr Lv 1 11 pts. 10,644
  8. Avatar for NeLikomSheet 48. NeLikomSheet Lv 1 11 pts. 10,613
  9. Avatar for BarrySampson 49. BarrySampson Lv 1 10 pts. 10,607
  10. Avatar for heather-1 50. heather-1 Lv 1 9 pts. 10,572

Comments