Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,454
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,853
  3. Avatar for Team China 13. Team China 1 pt. 9,277

  1. Avatar for CharaLilith 61. CharaLilith Lv 1 5 pts. 10,400
  2. Avatar for phi16 62. phi16 Lv 1 4 pts. 10,400
  3. Avatar for Pikkachurin 63. Pikkachurin Lv 1 4 pts. 10,400
  4. Avatar for borattt 64. borattt Lv 1 4 pts. 10,397
  5. Avatar for Oransche 65. Oransche Lv 1 4 pts. 10,396
  6. Avatar for equilibria 66. equilibria Lv 1 3 pts. 10,371
  7. Avatar for jawz101 67. jawz101 Lv 1 3 pts. 10,366
  8. Avatar for DScott 68. DScott Lv 1 3 pts. 10,299
  9. Avatar for AlkiP0Ps 69. AlkiP0Ps Lv 1 3 pts. 10,260
  10. Avatar for kevin everington 70. kevin everington Lv 1 3 pts. 10,242

Comments