Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,454
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,853
  3. Avatar for Team China 13. Team China 1 pt. 9,277

  1. Avatar for kitsoune 71. kitsoune Lv 1 2 pts. 10,239
  2. Avatar for Merf 72. Merf Lv 1 2 pts. 10,226
  3. Avatar for abiogenesis 73. abiogenesis Lv 1 2 pts. 10,213
  4. Avatar for Trajan464 74. Trajan464 Lv 1 2 pts. 10,211
  5. Avatar for MirsadaH 75. MirsadaH Lv 1 2 pts. 10,208
  6. Avatar for Beany 76. Beany Lv 1 2 pts. 10,174
  7. Avatar for Evica 77. Evica Lv 1 2 pts. 10,169
  8. Avatar for rinze 78. rinze Lv 1 2 pts. 10,162
  9. Avatar for Vinara 79. Vinara Lv 1 1 pt. 10,155
  10. Avatar for Larini 80. Larini Lv 1 1 pt. 10,121

Comments