Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,454
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,853
  3. Avatar for Team China 13. Team China 1 pt. 9,277
  1. Avatar for fpc 81. fpc Lv 1 1 pt. 10,118
  2. Avatar for pascal ochem 82. pascal ochem Lv 1 1 pt. 10,087
  3. Avatar for ivalnic 83. ivalnic Lv 1 1 pt. 10,086
  4. Avatar for Hellcat6 84. Hellcat6 Lv 1 1 pt. 10,057
  5. Avatar for andrewxc 85. andrewxc Lv 1 1 pt. 10,006
  6. Avatar for fishercat 86. fishercat Lv 1 1 pt. 9,999
  7. Avatar for cjddig 87. cjddig Lv 1 1 pt. 9,972
  8. Avatar for drumpeter18yrs9yrs 88. drumpeter18yrs9yrs Lv 1 1 pt. 9,971
  9. Avatar for antibot215 89. antibot215 Lv 1 1 pt. 9,966
  10. Avatar for Dr.Sillem 90. Dr.Sillem Lv 1 1 pt. 9,962

Comments