Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,292
  2. Avatar for Go Science 2. Go Science 65 pts. 11,219
  3. Avatar for Beta Folders 3. Beta Folders 41 pts. 11,208
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 11,166
  5. Avatar for Contenders 5. Contenders 14 pts. 11,144
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 10,932
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 10,811
  8. Avatar for Australia 8. Australia 2 pts. 10,751
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,697
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,654

  1. Avatar for PabloPP11 101. PabloPP11 Lv 1 1 pt. 9,645
  2. Avatar for Pathless 102. Pathless Lv 1 1 pt. 9,636
  3. Avatar for pfirth 103. pfirth Lv 1 1 pt. 9,608
  4. Avatar for alenters 104. alenters Lv 1 1 pt. 9,586
  5. Avatar for brucederby 105. brucederby Lv 1 1 pt. 9,570
  6. Avatar for LXRD 106. LXRD Lv 1 1 pt. 9,441
  7. Avatar for Swapper242 107. Swapper242 Lv 1 1 pt. 9,386
  8. Avatar for MonkeyGod 108. MonkeyGod Lv 1 1 pt. 9,374
  9. Avatar for JustinRothganger 109. JustinRothganger Lv 1 1 pt. 9,369
  10. Avatar for Jesus Anaya 110. Jesus Anaya Lv 1 1 pt. 9,282

Comments