Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 9,359
  2. Avatar for Australia 12. Australia 1 pt. 9,326
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,120
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team China 15. Team China 1 pt. 8,214
  6. Avatar for Deleted group 16. Deleted group pts. 4,879
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 4,879
  8. Avatar for Window Group 18. Window Group 1 pt. 4,879
  1. Avatar for abiogenesis 91. abiogenesis Lv 1 1 pt. 9,189
  2. Avatar for Beany 92. Beany Lv 1 1 pt. 9,186
  3. Avatar for Todd6485577 93. Todd6485577 Lv 1 1 pt. 9,154
  4. Avatar for pascal ochem 94. pascal ochem Lv 1 1 pt. 9,146
  5. Avatar for Savas 95. Savas Lv 1 1 pt. 9,120
  6. Avatar for antibot215 96. antibot215 Lv 1 1 pt. 9,110
  7. Avatar for matt61ger 97. matt61ger Lv 1 1 pt. 9,081
  8. Avatar for Altercomp 98. Altercomp Lv 1 1 pt. 9,071
  9. Avatar for davidandersoniii 99. davidandersoniii Lv 1 1 pt. 9,062
  10. Avatar for Frances Middleton-Davis 100. Frances Middleton-Davis Lv 1 1 pt. 9,060

Comments