Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,752
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,722
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,696
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,502
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,356
  6. Avatar for Contenders 6. Contenders 18 pts. 10,321
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,215
  8. Avatar for BOINC@Poland 8. BOINC@Poland 8 pts. 10,079
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,796
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,461
  1. Avatar for abiogenesis 91. abiogenesis Lv 1 1 pt. 9,189
  2. Avatar for Beany 92. Beany Lv 1 1 pt. 9,186
  3. Avatar for Todd6485577 93. Todd6485577 Lv 1 1 pt. 9,154
  4. Avatar for pascal ochem 94. pascal ochem Lv 1 1 pt. 9,146
  5. Avatar for Savas 95. Savas Lv 1 1 pt. 9,120
  6. Avatar for antibot215 96. antibot215 Lv 1 1 pt. 9,110
  7. Avatar for matt61ger 97. matt61ger Lv 1 1 pt. 9,081
  8. Avatar for Altercomp 98. Altercomp Lv 1 1 pt. 9,071
  9. Avatar for davidandersoniii 99. davidandersoniii Lv 1 1 pt. 9,062
  10. Avatar for Frances Middleton-Davis 100. Frances Middleton-Davis Lv 1 1 pt. 9,060

Comments