Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 9,359
  2. Avatar for Australia 12. Australia 1 pt. 9,326
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,120
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team China 15. Team China 1 pt. 8,214
  6. Avatar for Deleted group 16. Deleted group pts. 4,879
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 4,879
  8. Avatar for Window Group 18. Window Group 1 pt. 4,879
  1. Avatar for scottwuzhear 111. scottwuzhear Lv 1 1 pt. 8,579
  2. Avatar for Ergsterfalter 112. Ergsterfalter Lv 1 1 pt. 8,526
  3. Avatar for Timmy99 113. Timmy99 Lv 1 1 pt. 8,498
  4. Avatar for amoensia 114. amoensia Lv 1 1 pt. 8,418
  5. Avatar for janchris 115. janchris Lv 1 1 pt. 8,392
  6. Avatar for Giantbluefish 116. Giantbluefish Lv 1 1 pt. 8,347
  7. Avatar for AbDesigner 117. AbDesigner Lv 1 1 pt. 8,214
  8. Avatar for GauriT 118. GauriT Lv 1 1 pt. 8,184
  9. Avatar for Yiden 119. Yiden Lv 1 1 pt. 8,179
  10. Avatar for Sammy3c2b1a0 120. Sammy3c2b1a0 Lv 1 1 pt. 8,149

Comments