Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,752
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,722
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,696
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,502
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,356
  6. Avatar for Contenders 6. Contenders 18 pts. 10,321
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,215
  8. Avatar for BOINC@Poland 8. BOINC@Poland 8 pts. 10,079
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,796
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,461
  1. Avatar for scottwuzhear 111. scottwuzhear Lv 1 1 pt. 8,579
  2. Avatar for Ergsterfalter 112. Ergsterfalter Lv 1 1 pt. 8,526
  3. Avatar for Timmy99 113. Timmy99 Lv 1 1 pt. 8,498
  4. Avatar for amoensia 114. amoensia Lv 1 1 pt. 8,418
  5. Avatar for janchris 115. janchris Lv 1 1 pt. 8,392
  6. Avatar for Giantbluefish 116. Giantbluefish Lv 1 1 pt. 8,347
  7. Avatar for AbDesigner 117. AbDesigner Lv 1 1 pt. 8,214
  8. Avatar for GauriT 118. GauriT Lv 1 1 pt. 8,184
  9. Avatar for Yiden 119. Yiden Lv 1 1 pt. 8,179
  10. Avatar for Sammy3c2b1a0 120. Sammy3c2b1a0 Lv 1 1 pt. 8,149

Comments