Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 9,359
  2. Avatar for Australia 12. Australia 1 pt. 9,326
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,120
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team China 15. Team China 1 pt. 8,214
  6. Avatar for Deleted group 16. Deleted group pts. 4,879
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 4,879
  8. Avatar for Window Group 18. Window Group 1 pt. 4,879
  1. Avatar for Ragstten 121. Ragstten Lv 1 1 pt. 8,143
  2. Avatar for Gematron 2874 122. Gematron 2874 Lv 1 1 pt. 8,131
  3. Avatar for h702196182 123. h702196182 Lv 1 1 pt. 8,119
  4. Avatar for Swapper242 124. Swapper242 Lv 1 1 pt. 7,722
  5. Avatar for furi0us 125. furi0us Lv 1 1 pt. 7,679
  6. Avatar for deathbat_87 126. deathbat_87 Lv 1 1 pt. 7,678
  7. Avatar for zo3xiaJonWeinberg 127. zo3xiaJonWeinberg Lv 1 1 pt. 7,612
  8. Avatar for savewitnus 128. savewitnus Lv 1 1 pt. 7,533
  9. Avatar for iguslara 129. iguslara Lv 1 1 pt. 7,488
  10. Avatar for raymondanthony03 130. raymondanthony03 Lv 1 1 pt. 7,344

Comments