Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,752
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,722
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,696
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,502
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,356
  6. Avatar for Contenders 6. Contenders 18 pts. 10,321
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,215
  8. Avatar for BOINC@Poland 8. BOINC@Poland 8 pts. 10,079
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,796
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,461
  1. Avatar for Ragstten 121. Ragstten Lv 1 1 pt. 8,143
  2. Avatar for Gematron 2874 122. Gematron 2874 Lv 1 1 pt. 8,131
  3. Avatar for h702196182 123. h702196182 Lv 1 1 pt. 8,119
  4. Avatar for Swapper242 124. Swapper242 Lv 1 1 pt. 7,722
  5. Avatar for furi0us 125. furi0us Lv 1 1 pt. 7,679
  6. Avatar for deathbat_87 126. deathbat_87 Lv 1 1 pt. 7,678
  7. Avatar for zo3xiaJonWeinberg 127. zo3xiaJonWeinberg Lv 1 1 pt. 7,612
  8. Avatar for savewitnus 128. savewitnus Lv 1 1 pt. 7,533
  9. Avatar for iguslara 129. iguslara Lv 1 1 pt. 7,488
  10. Avatar for raymondanthony03 130. raymondanthony03 Lv 1 1 pt. 7,344

Comments