Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 9,359
  2. Avatar for Australia 12. Australia 1 pt. 9,326
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,120
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team China 15. Team China 1 pt. 8,214
  6. Avatar for Deleted group 16. Deleted group pts. 4,879
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 4,879
  8. Avatar for Window Group 18. Window Group 1 pt. 4,879
  1. Avatar for NeLikomSheet 11. NeLikomSheet Lv 1 70 pts. 10,461
  2. Avatar for robgee 12. robgee Lv 1 68 pts. 10,461
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 65 pts. 10,409
  4. Avatar for g_b 14. g_b Lv 1 63 pts. 10,398
  5. Avatar for Lotus23 15. Lotus23 Lv 1 61 pts. 10,373
  6. Avatar for jobo0502 16. jobo0502 Lv 1 58 pts. 10,356
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 56 pts. 10,341
  8. Avatar for nicobul 18. nicobul Lv 1 54 pts. 10,335
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 52 pts. 10,321
  10. Avatar for NPrincipi 20. NPrincipi Lv 1 50 pts. 10,305

Comments