Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,752
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,722
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,696
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,502
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,356
  6. Avatar for Contenders 6. Contenders 18 pts. 10,321
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,215
  8. Avatar for BOINC@Poland 8. BOINC@Poland 8 pts. 10,079
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,796
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,461
  1. Avatar for NeLikomSheet 11. NeLikomSheet Lv 1 70 pts. 10,461
  2. Avatar for robgee 12. robgee Lv 1 68 pts. 10,461
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 65 pts. 10,409
  4. Avatar for g_b 14. g_b Lv 1 63 pts. 10,398
  5. Avatar for Lotus23 15. Lotus23 Lv 1 61 pts. 10,373
  6. Avatar for jobo0502 16. jobo0502 Lv 1 58 pts. 10,356
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 56 pts. 10,341
  8. Avatar for nicobul 18. nicobul Lv 1 54 pts. 10,335
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 52 pts. 10,321
  10. Avatar for NPrincipi 20. NPrincipi Lv 1 50 pts. 10,305

Comments