Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 9,359
  2. Avatar for Australia 12. Australia 1 pt. 9,326
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,120
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team China 15. Team China 1 pt. 8,214
  6. Avatar for Deleted group 16. Deleted group pts. 4,879
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 4,879
  8. Avatar for Window Group 18. Window Group 1 pt. 4,879
  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 48 pts. 10,293
  2. Avatar for phi16 22. phi16 Lv 1 46 pts. 10,286
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 44 pts. 10,284
  4. Avatar for PeterDav 24. PeterDav Lv 1 43 pts. 10,277
  5. Avatar for akaaka 25. akaaka Lv 1 41 pts. 10,259
  6. Avatar for Threeoak 26. Threeoak Lv 1 39 pts. 10,248
  7. Avatar for Deleted player 27. Deleted player 38 pts. 10,234
  8. Avatar for frood66 28. frood66 Lv 1 36 pts. 10,230
  9. Avatar for Museka 29. Museka Lv 1 35 pts. 10,222
  10. Avatar for Skippysk8s 30. Skippysk8s Lv 1 33 pts. 10,215

Comments