Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,752
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,722
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,696
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,502
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,356
  6. Avatar for Contenders 6. Contenders 18 pts. 10,321
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,215
  8. Avatar for BOINC@Poland 8. BOINC@Poland 8 pts. 10,079
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,796
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,461
  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 48 pts. 10,293
  2. Avatar for phi16 22. phi16 Lv 1 46 pts. 10,286
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 44 pts. 10,284
  4. Avatar for PeterDav 24. PeterDav Lv 1 43 pts. 10,277
  5. Avatar for akaaka 25. akaaka Lv 1 41 pts. 10,259
  6. Avatar for Threeoak 26. Threeoak Lv 1 39 pts. 10,248
  7. Avatar for Deleted player 27. Deleted player 38 pts. 10,234
  8. Avatar for frood66 28. frood66 Lv 1 36 pts. 10,230
  9. Avatar for Museka 29. Museka Lv 1 35 pts. 10,222
  10. Avatar for Skippysk8s 30. Skippysk8s Lv 1 33 pts. 10,215

Comments