Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,970
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 8,507
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,266
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,758
  5. Avatar for test 2 15. test 2 1 pt. 7,393
  6. Avatar for Window Group 16. Window Group 1 pt. 7,076

  1. Avatar for pfirth 91. pfirth Lv 1 1 pt. 8,350
  2. Avatar for Franky0045 92. Franky0045 Lv 1 1 pt. 8,303
  3. Avatar for Mohoernchen 93. Mohoernchen Lv 1 1 pt. 8,294
  4. Avatar for EmmyBee 94. EmmyBee Lv 1 1 pt. 8,294
  5. Avatar for diamonddays 95. diamonddays Lv 1 1 pt. 8,272
  6. Avatar for pascal ochem 96. pascal ochem Lv 1 1 pt. 8,269
  7. Avatar for dahast.de 97. dahast.de Lv 1 1 pt. 8,266
  8. Avatar for jamestpierce 98. jamestpierce Lv 1 1 pt. 8,265
  9. Avatar for protein_crown13 99. protein_crown13 Lv 1 1 pt. 8,262

Comments