Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,970
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 8,507
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,266
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,758
  5. Avatar for test 2 15. test 2 1 pt. 7,393
  6. Avatar for Window Group 16. Window Group 1 pt. 7,076

  1. Avatar for hada 101. hada Lv 1 1 pt. 8,253
  2. Avatar for zim57 103. zim57 Lv 1 1 pt. 8,217
  3. Avatar for RudyLis 104. RudyLis Lv 1 1 pt. 8,211
  4. Avatar for Oransche 105. Oransche Lv 1 1 pt. 8,211
  5. Avatar for antibot215 106. antibot215 Lv 1 1 pt. 8,206
  6. Avatar for Bucsan 107. Bucsan Lv 1 1 pt. 8,187
  7. Avatar for scottwuzhear 108. scottwuzhear Lv 1 1 pt. 8,165
  8. Avatar for fearjuan 109. fearjuan Lv 1 1 pt. 8,115
  9. Avatar for xiscorompa 110. xiscorompa Lv 1 1 pt. 8,112

Comments