Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since almost 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,970
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 8,507
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,266
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,758
  5. Avatar for test 2 15. test 2 1 pt. 7,393
  6. Avatar for Window Group 16. Window Group 1 pt. 7,076

  1. Avatar for g_b 11. g_b Lv 1 71 pts. 9,633
  2. Avatar for silent gene 12. silent gene Lv 1 68 pts. 9,620
  3. Avatar for stomjoh 13. stomjoh Lv 1 66 pts. 9,620
  4. Avatar for Galaxie 14. Galaxie Lv 1 64 pts. 9,611
  5. Avatar for jobo0502 15. jobo0502 Lv 1 61 pts. 9,605
  6. Avatar for guineapig 16. guineapig Lv 1 59 pts. 9,557
  7. Avatar for robgee 17. robgee Lv 1 57 pts. 9,544
  8. Avatar for fpc 18. fpc Lv 1 55 pts. 9,543
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 53 pts. 9,513
  10. Avatar for akaaka 20. akaaka Lv 1 51 pts. 9,503

Comments