Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,970
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 8,507
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,266
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,758
  5. Avatar for test 2 15. test 2 1 pt. 7,393
  6. Avatar for Window Group 16. Window Group 1 pt. 7,076

  1. Avatar for fiendish_ghoul 21. fiendish_ghoul Lv 1 49 pts. 9,502
  2. Avatar for johnmitch 22. johnmitch Lv 1 47 pts. 9,480
  3. Avatar for Gerom 23. Gerom Lv 1 45 pts. 9,479
  4. Avatar for nicobul 24. nicobul Lv 1 43 pts. 9,473
  5. Avatar for WBarme1234 25. WBarme1234 Lv 1 42 pts. 9,469
  6. Avatar for ZeroLeak7 26. ZeroLeak7 Lv 1 40 pts. 9,465
  7. Avatar for Bruno Kestemont 27. Bruno Kestemont Lv 1 39 pts. 9,453
  8. Avatar for NeLikomSheet 28. NeLikomSheet Lv 1 37 pts. 9,402
  9. Avatar for infjamc 29. infjamc Lv 1 36 pts. 9,391
  10. Avatar for NinjaGreg 30. NinjaGreg Lv 1 34 pts. 9,366

Comments