Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,970
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 8,507
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,266
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,758
  5. Avatar for test 2 15. test 2 1 pt. 7,393
  6. Avatar for Window Group 16. Window Group 1 pt. 7,076

  1. Avatar for jausmh 31. jausmh Lv 1 33 pts. 9,348
  2. Avatar for Phyx 32. Phyx Lv 1 31 pts. 9,340
  3. Avatar for Crossed Sticks 33. Crossed Sticks Lv 1 30 pts. 9,316
  4. Avatar for tracybutt 34. tracybutt Lv 1 29 pts. 9,314
  5. Avatar for BarrySampson 35. BarrySampson Lv 1 28 pts. 9,309
  6. Avatar for BootsMcGraw 36. BootsMcGraw Lv 1 26 pts. 9,286
  7. Avatar for CharaLilith 37. CharaLilith Lv 1 25 pts. 9,282
  8. Avatar for NPrincipi 38. NPrincipi Lv 1 24 pts. 9,272
  9. Avatar for katling 39. katling Lv 1 23 pts. 9,265
  10. Avatar for alcor29 40. alcor29 Lv 1 22 pts. 9,251

Comments