Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,970
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 8,507
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,266
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,758
  5. Avatar for test 2 15. test 2 1 pt. 7,393
  6. Avatar for Window Group 16. Window Group 1 pt. 7,076

  1. Avatar for toshiue 41. toshiue Lv 1 21 pts. 9,236
  2. Avatar for blazegeek 42. blazegeek Lv 1 20 pts. 9,223
  3. Avatar for heather-1 43. heather-1 Lv 1 19 pts. 9,218
  4. Avatar for jawz101 44. jawz101 Lv 1 18 pts. 9,212
  5. Avatar for AlkiP0Ps 45. AlkiP0Ps Lv 1 18 pts. 9,186
  6. Avatar for donuts554 46. donuts554 Lv 1 17 pts. 9,185
  7. Avatar for Lotus23 47. Lotus23 Lv 1 16 pts. 9,176
  8. Avatar for georg137 48. georg137 Lv 1 15 pts. 9,175
  9. Avatar for phi16 49. phi16 Lv 1 15 pts. 9,170
  10. Avatar for abiogenesis 50. abiogenesis Lv 1 14 pts. 9,166

Comments