Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,970
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 8,507
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,266
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,758
  5. Avatar for test 2 15. test 2 1 pt. 7,393
  6. Avatar for Window Group 16. Window Group 1 pt. 7,076

  1. Avatar for equilibria 51. equilibria Lv 1 13 pts. 9,155
  2. Avatar for Museka 52. Museka Lv 1 13 pts. 9,147
  3. Avatar for ShadowTactics 53. ShadowTactics Lv 1 12 pts. 9,068
  4. Avatar for CamelCaseCam 54. CamelCaseCam Lv 1 11 pts. 9,037
  5. Avatar for cjddig 55. cjddig Lv 1 11 pts. 9,021
  6. Avatar for Deleted player 56. Deleted player pts. 9,018
  7. Avatar for Threeoak 57. Threeoak Lv 1 10 pts. 8,981
  8. Avatar for borattt 58. borattt Lv 1 9 pts. 8,975
  9. Avatar for ProfVince 59. ProfVince Lv 1 9 pts. 8,973
  10. Avatar for pmthomson90 60. pmthomson90 Lv 1 8 pts. 8,970

Comments