Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,970
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 8,507
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,266
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,758
  5. Avatar for test 2 15. test 2 1 pt. 7,393
  6. Avatar for Window Group 16. Window Group 1 pt. 7,076

  1. Avatar for Pazithi 61. Pazithi Lv 1 8 pts. 8,940
  2. Avatar for MrZanav 62. MrZanav Lv 1 8 pts. 8,902
  3. Avatar for fishercat 63. fishercat Lv 1 7 pts. 8,857
  4. Avatar for Hellcat6 64. Hellcat6 Lv 1 7 pts. 8,847
  5. Avatar for zgf2022 65. zgf2022 Lv 1 6 pts. 8,771
  6. Avatar for zackallen 66. zackallen Lv 1 6 pts. 8,750
  7. Avatar for bamh 67. bamh Lv 1 6 pts. 8,707
  8. Avatar for kevin everington 68. kevin everington Lv 1 5 pts. 8,671
  9. Avatar for Evica 69. Evica Lv 1 5 pts. 8,670
  10. Avatar for dettingen 70. dettingen Lv 1 5 pts. 8,649

Comments