Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,970
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 8,507
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,266
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,758
  5. Avatar for test 2 15. test 2 1 pt. 7,393
  6. Avatar for Window Group 16. Window Group 1 pt. 7,076

  1. Avatar for Squirrely 71. Squirrely Lv 1 5 pts. 8,627
  2. Avatar for Arne Heessels 72. Arne Heessels Lv 1 4 pts. 8,594
  3. Avatar for ManVsYard 73. ManVsYard Lv 1 4 pts. 8,586
  4. Avatar for DScott 74. DScott Lv 1 4 pts. 8,575
  5. Avatar for rezaefar 75. rezaefar Lv 1 4 pts. 8,561
  6. Avatar for maithra 76. maithra Lv 1 3 pts. 8,548
  7. Avatar for Merf 77. Merf Lv 1 3 pts. 8,546
  8. Avatar for rabamino12358 78. rabamino12358 Lv 1 3 pts. 8,525
  9. Avatar for Wiz kid 79. Wiz kid Lv 1 3 pts. 8,523
  10. Avatar for MirsadaH 80. MirsadaH Lv 1 3 pts. 8,507

Comments