Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,596
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,559
  3. Avatar for Learn When To Fold It 13. Learn When To Fold It 1 pt. 9,224
  4. Avatar for test_group1 14. test_group1 1 pt. 0
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 0
  6. Avatar for test 2 16. test 2 1 pt. 0
  7. Avatar for Window Group 17. Window Group 1 pt. 0
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,195
  2. Avatar for grogar7 2. grogar7 Lv 1 71 pts. 10,184
  3. Avatar for robgee 3. robgee Lv 1 49 pts. 10,181
  4. Avatar for phi16 4. phi16 Lv 1 33 pts. 10,180
  5. Avatar for gdnskye 5. gdnskye Lv 1 22 pts. 10,178
  6. Avatar for alcor29 6. alcor29 Lv 1 14 pts. 10,176
  7. Avatar for gmn 7. gmn Lv 1 8 pts. 10,176
  8. Avatar for Phyx 8. Phyx Lv 1 5 pts. 10,174
  9. Avatar for toshiue 9. toshiue Lv 1 3 pts. 10,173
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 2 pts. 10,158

Comments