Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,195
  2. Avatar for Go Science 2. Go Science 73 pts. 10,174
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,153
  4. Avatar for Contenders 4. Contenders 36 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,076
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,069
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,971
  8. Avatar for Russian team 8. Russian team 6 pts. 9,906
  9. Avatar for Australia 9. Australia 4 pts. 9,866
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,701

  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 10,188
  2. Avatar for sallallami 2. sallallami Lv 1 97 pts. 10,179
  3. Avatar for Galaxie 3. Galaxie Lv 1 94 pts. 10,176
  4. Avatar for mirp 4. mirp Lv 1 91 pts. 10,158
  5. Avatar for LociOiling 5. LociOiling Lv 1 87 pts. 10,152
  6. Avatar for g_b 6. g_b Lv 1 84 pts. 10,140
  7. Avatar for georg137 7. georg137 Lv 1 81 pts. 10,135
  8. Avatar for alcor29 8. alcor29 Lv 1 78 pts. 10,119
  9. Avatar for robgee 9. robgee Lv 1 76 pts. 10,111
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 73 pts. 10,105

Comments