Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,596
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,559
  3. Avatar for Learn When To Fold It 13. Learn When To Fold It 1 pt. 9,224
  4. Avatar for test_group1 14. test_group1 1 pt. 0
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 0
  6. Avatar for test 2 16. test 2 1 pt. 0
  7. Avatar for Window Group 17. Window Group 1 pt. 0
  1. Avatar for antibot215 121. antibot215 Lv 1 1 pt. 9,089
  2. Avatar for Gygy 122. Gygy Lv 1 1 pt. 9,006
  3. Avatar for yuemin ma 123. yuemin ma Lv 1 1 pt. 9,002
  4. Avatar for ajgranados 124. ajgranados Lv 1 1 pt. 8,965
  5. Avatar for gdnskye 125. gdnskye Lv 1 1 pt. 8,833
  6. Avatar for scottwuzhear 126. scottwuzhear Lv 1 1 pt. 8,811
  7. Avatar for maria.panteghini 127. maria.panteghini Lv 1 1 pt. 8,790
  8. Avatar for JackSangster 128. JackSangster Lv 1 1 pt. 8,768
  9. Avatar for Indraneel 129. Indraneel Lv 1 1 pt. 8,755
  10. Avatar for Sakai Izumi 130. Sakai Izumi Lv 1 1 pt. 8,637

Comments