Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,596
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,559
  3. Avatar for Learn When To Fold It 13. Learn When To Fold It 1 pt. 9,224
  4. Avatar for test_group1 14. test_group1 1 pt. 0
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 0
  6. Avatar for test 2 16. test 2 1 pt. 0
  7. Avatar for Window Group 17. Window Group 1 pt. 0
  1. Avatar for heather-1 61. heather-1 Lv 1 7 pts. 9,769
  2. Avatar for zem 62. zem Lv 1 7 pts. 9,756
  3. Avatar for bamh 63. bamh Lv 1 6 pts. 9,754
  4. Avatar for infjamc 64. infjamc Lv 1 6 pts. 9,744
  5. Avatar for hada 65. hada Lv 1 6 pts. 9,734
  6. Avatar for Oransche 66. Oransche Lv 1 5 pts. 9,715
  7. Avatar for CharaLilith 67. CharaLilith Lv 1 5 pts. 9,704
  8. Avatar for ShadowTactics 68. ShadowTactics Lv 1 5 pts. 9,701
  9. Avatar for EmmyBee 69. EmmyBee Lv 1 5 pts. 9,695
  10. Avatar for Evica 70. Evica Lv 1 4 pts. 9,692

Comments