Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,596
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,559
  3. Avatar for Learn When To Fold It 13. Learn When To Fold It 1 pt. 9,224
  4. Avatar for test_group1 14. test_group1 1 pt. 0
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 0
  6. Avatar for test 2 16. test 2 1 pt. 0
  7. Avatar for Window Group 17. Window Group 1 pt. 0
  1. Avatar for frostschutz 71. frostschutz Lv 1 4 pts. 9,689
  2. Avatar for MrZanav 72. MrZanav Lv 1 4 pts. 9,685
  3. Avatar for abiogenesis 73. abiogenesis Lv 1 4 pts. 9,671
  4. Avatar for Trajan464 74. Trajan464 Lv 1 3 pts. 9,649
  5. Avatar for Manocha_45741069 75. Manocha_45741069 Lv 1 3 pts. 9,644
  6. Avatar for Hellcat6 76. Hellcat6 Lv 1 3 pts. 9,638
  7. Avatar for isaksson 77. isaksson Lv 1 3 pts. 9,636
  8. Avatar for AmaralMo 78. AmaralMo Lv 1 3 pts. 9,629
  9. Avatar for Frances Middleton-Davis 79. Frances Middleton-Davis Lv 1 3 pts. 9,628
  10. Avatar for Merf 80. Merf Lv 1 2 pts. 9,625

Comments