Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,195
  2. Avatar for Go Science 2. Go Science 73 pts. 10,174
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,153
  4. Avatar for Contenders 4. Contenders 36 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,076
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,069
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,971
  8. Avatar for Russian team 8. Russian team 6 pts. 9,906
  9. Avatar for Australia 9. Australia 4 pts. 9,866
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,701

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,195
  2. Avatar for grogar7 2. grogar7 Lv 1 71 pts. 10,184
  3. Avatar for robgee 3. robgee Lv 1 49 pts. 10,181
  4. Avatar for phi16 4. phi16 Lv 1 33 pts. 10,180
  5. Avatar for gdnskye 5. gdnskye Lv 1 22 pts. 10,178
  6. Avatar for alcor29 6. alcor29 Lv 1 14 pts. 10,176
  7. Avatar for gmn 7. gmn Lv 1 8 pts. 10,176
  8. Avatar for Phyx 8. Phyx Lv 1 5 pts. 10,174
  9. Avatar for toshiue 9. toshiue Lv 1 3 pts. 10,173
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 2 pts. 10,158

Comments