Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,366
  2. Avatar for chem2523 assignment 12. chem2523 assignment 1 pt. 8,973
  3. Avatar for Russian team 13. Russian team 1 pt. 8,953
  4. Avatar for Team China 14. Team China 1 pt. 8,387
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,685
  6. Avatar for Window Group 16. Window Group 1 pt. 7,646
  7. Avatar for IBS BCS 17. IBS BCS 1 pt. 6,482
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,378
  2. Avatar for grogar7 2. grogar7 Lv 1 98 pts. 10,374
  3. Avatar for sallallami 3. sallallami Lv 1 95 pts. 10,299
  4. Avatar for g_b 4. g_b Lv 1 92 pts. 10,199
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 90 pts. 10,164
  6. Avatar for frood66 6. frood66 Lv 1 87 pts. 10,163
  7. Avatar for Galaxie 7. Galaxie Lv 1 85 pts. 10,144
  8. Avatar for NeLikomSheet 8. NeLikomSheet Lv 1 82 pts. 10,142
  9. Avatar for gmn 9. gmn Lv 1 80 pts. 10,104
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 78 pts. 10,103

Comments