Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Beta Folders 100 pts. 10,384
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,381
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,184
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 10,103
  5. Avatar for Contenders 5. Contenders 24 pts. 10,072
  6. Avatar for Go Science 6. Go Science 16 pts. 10,071
  7. Avatar for SETI.Germany 7. SETI.Germany 10 pts. 9,613
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,595
  9. Avatar for Australia 9. Australia 4 pts. 9,429
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,416

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,378
  2. Avatar for grogar7 2. grogar7 Lv 1 98 pts. 10,374
  3. Avatar for sallallami 3. sallallami Lv 1 95 pts. 10,299
  4. Avatar for g_b 4. g_b Lv 1 92 pts. 10,199
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 90 pts. 10,164
  6. Avatar for frood66 6. frood66 Lv 1 87 pts. 10,163
  7. Avatar for Galaxie 7. Galaxie Lv 1 85 pts. 10,144
  8. Avatar for NeLikomSheet 8. NeLikomSheet Lv 1 82 pts. 10,142
  9. Avatar for gmn 9. gmn Lv 1 80 pts. 10,104
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 78 pts. 10,103

Comments