Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since almost 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,366
  2. Avatar for chem2523 assignment 12. chem2523 assignment 1 pt. 8,973
  3. Avatar for Russian team 13. Russian team 1 pt. 8,953
  4. Avatar for Team China 14. Team China 1 pt. 8,387
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,685
  6. Avatar for Window Group 16. Window Group 1 pt. 7,646
  7. Avatar for IBS BCS 17. IBS BCS 1 pt. 6,482

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,384
  2. Avatar for Galaxie 2. Galaxie Lv 1 77 pts. 10,381
  3. Avatar for gmn 3. gmn Lv 1 58 pts. 10,361
  4. Avatar for robgee 4. robgee Lv 1 43 pts. 10,356
  5. Avatar for alcor29 5. alcor29 Lv 1 31 pts. 10,354
  6. Avatar for Deleted player 6. Deleted player 22 pts. 10,353
  7. Avatar for gdnskye 7. gdnskye Lv 1 15 pts. 10,350
  8. Avatar for fpc 8. fpc Lv 1 11 pts. 10,184
  9. Avatar for jausmh 9. jausmh Lv 1 7 pts. 10,178
  10. Avatar for toshiue 10. toshiue Lv 1 5 pts. 10,071

Comments