Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Beta Folders 100 pts. 10,384
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,381
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,184
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 10,103
  5. Avatar for Contenders 5. Contenders 24 pts. 10,072
  6. Avatar for Go Science 6. Go Science 16 pts. 10,071
  7. Avatar for SETI.Germany 7. SETI.Germany 10 pts. 9,613
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,595
  9. Avatar for Australia 9. Australia 4 pts. 9,429
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,416

  1. Avatar for Zosa 91. Zosa Lv 1 3 pts. 9,238
  2. Avatar for MrZanav 92. MrZanav Lv 1 3 pts. 9,223
  3. Avatar for kevin everington 93. kevin everington Lv 1 3 pts. 9,216
  4. Avatar for frostschutz 94. frostschutz Lv 1 3 pts. 9,213
  5. Avatar for davidandersoniii 95. davidandersoniii Lv 1 3 pts. 9,192
  6. Avatar for Beany 96. Beany Lv 1 3 pts. 9,172
  7. Avatar for Arne Heessels 97. Arne Heessels Lv 1 3 pts. 9,165
  8. Avatar for abiogenesis 98. abiogenesis Lv 1 2 pts. 9,165
  9. Avatar for Dr.Sillem 99. Dr.Sillem Lv 1 2 pts. 9,160
  10. Avatar for pascal ochem 100. pascal ochem Lv 1 2 pts. 9,141

Comments