Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,105
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 10,068
  3. Avatar for Australia 13. Australia 1 pt. 10,034
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,885
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,819
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 8,953
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,600
  8. Avatar for Window Group 18. Window Group 1 pt. 4,734
  1. Avatar for equilibria 91. equilibria Lv 1 2 pts. 9,852
  2. Avatar for Borets 92. Borets Lv 1 2 pts. 9,845
  3. Avatar for Alistair69 93. Alistair69 Lv 1 2 pts. 9,840
  4. Avatar for Dr.Sillem 94. Dr.Sillem Lv 1 2 pts. 9,836
  5. Avatar for DScott 95. DScott Lv 1 2 pts. 9,822
  6. Avatar for ShadowTactics 96. ShadowTactics Lv 1 1 pt. 9,819
  7. Avatar for Hellcat6 97. Hellcat6 Lv 1 1 pt. 9,817
  8. Avatar for Mohoernchen 98. Mohoernchen Lv 1 1 pt. 9,814
  9. Avatar for antibot215 99. antibot215 Lv 1 1 pt. 9,801
  10. Avatar for hada 100. hada Lv 1 1 pt. 9,784

Comments