Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,735
  2. Avatar for Go Science 2. Go Science 74 pts. 10,728
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,661
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,614
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,607
  6. Avatar for Contenders 6. Contenders 18 pts. 10,595
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,574
  8. Avatar for AlphaFold 8. AlphaFold 8 pts. 10,552
  9. Avatar for Kotocycle 9. Kotocycle 5 pts. 10,190
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 10,122
  1. Avatar for Enzyme
    1. Enzyme Lv 1
    100 pts. 10,735
  2. Avatar for Phyx 2. Phyx Lv 1 97 pts. 10,725
  3. Avatar for sallallami 3. sallallami Lv 1 94 pts. 10,707
  4. Avatar for LociOiling 4. LociOiling Lv 1 91 pts. 10,661
  5. Avatar for g_b 5. g_b Lv 1 88 pts. 10,661
  6. Avatar for guineapig 6. guineapig Lv 1 86 pts. 10,634
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 83 pts. 10,614
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 80 pts. 10,612
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 77 pts. 10,596
  10. Avatar for BootsMcGraw 10. BootsMcGraw Lv 1 75 pts. 10,595

Comments