Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,105
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 10,068
  3. Avatar for Australia 13. Australia 1 pt. 10,034
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,885
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,819
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 8,953
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,600
  8. Avatar for Window Group 18. Window Group 1 pt. 4,734
  1. Avatar for DisboardGames 111. DisboardGames Lv 1 1 pt. 9,353
  2. Avatar for ivalnic 112. ivalnic Lv 1 1 pt. 9,350
  3. Avatar for Larini 113. Larini Lv 1 1 pt. 9,346
  4. Avatar for LouisYuan 114. LouisYuan Lv 1 1 pt. 9,342
  5. Avatar for shettler 115. shettler Lv 1 1 pt. 9,336
  6. Avatar for A-Selkie-Abroad 116. A-Selkie-Abroad Lv 1 1 pt. 9,333
  7. Avatar for scientist13 117. scientist13 Lv 1 1 pt. 9,329
  8. Avatar for BathBall 118. BathBall Lv 1 1 pt. 9,325
  9. Avatar for Jenot96 119. Jenot96 Lv 1 1 pt. 9,325
  10. Avatar for Chauncy 120. Chauncy Lv 1 1 pt. 9,274

Comments