Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,105
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 10,068
  3. Avatar for Australia 13. Australia 1 pt. 10,034
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,885
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,819
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 8,953
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,600
  8. Avatar for Window Group 18. Window Group 1 pt. 4,734
  1. Avatar for lightunifly 141. lightunifly Lv 1 1 pt. 8,241
  2. Avatar for Wellele12 142. Wellele12 Lv 1 1 pt. 7,819
  3. Avatar for maelizar 143. maelizar Lv 1 1 pt. 7,376
  4. Avatar for alexisjones 144. alexisjones Lv 1 1 pt. 7,350
  5. Avatar for Victorialove21 145. Victorialove21 Lv 1 1 pt. 7,298
  6. Avatar for jeher 146. jeher Lv 1 1 pt. 7,270
  7. Avatar for Sciren 147. Sciren Lv 1 1 pt. 6,734
  8. Avatar for El_Muchacho 148. El_Muchacho Lv 1 1 pt. 4,734
  9. Avatar for salmacantu 149. salmacantu Lv 1 1 pt. 4,734
  10. Avatar for jausmh 150. jausmh Lv 1 1 pt. 4,734

Comments