Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,105
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 10,068
  3. Avatar for Australia 13. Australia 1 pt. 10,034
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,885
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,819
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 8,953
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,600
  8. Avatar for Window Group 18. Window Group 1 pt. 4,734
  1. Avatar for dcrwheeler 31. dcrwheeler Lv 1 35 pts. 10,355
  2. Avatar for ProfVince 32. ProfVince Lv 1 34 pts. 10,342
  3. Avatar for Lotus23 33. Lotus23 Lv 1 32 pts. 10,335
  4. Avatar for Deleted player 34. Deleted player pts. 10,327
  5. Avatar for WBarme1234 35. WBarme1234 Lv 1 30 pts. 10,322
  6. Avatar for MicElephant 36. MicElephant Lv 1 29 pts. 10,297
  7. Avatar for NPrincipi 37. NPrincipi Lv 1 28 pts. 10,283
  8. Avatar for PeterDav 38. PeterDav Lv 1 27 pts. 10,282
  9. Avatar for Norrjane 39. Norrjane Lv 1 26 pts. 10,280
  10. Avatar for dpmattingly 40. dpmattingly Lv 1 24 pts. 10,274

Comments