Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,105
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 10,068
  3. Avatar for Australia 13. Australia 1 pt. 10,034
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,885
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,819
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 8,953
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,600
  8. Avatar for Window Group 18. Window Group 1 pt. 4,734
  1. Avatar for BarrySampson 41. BarrySampson Lv 1 23 pts. 10,253
  2. Avatar for Zosa 42. Zosa Lv 1 23 pts. 10,249
  3. Avatar for xythus 43. xythus Lv 1 22 pts. 10,242
  4. Avatar for Todd6485577 44. Todd6485577 Lv 1 21 pts. 10,239
  5. Avatar for fpc 45. fpc Lv 1 20 pts. 10,230
  6. Avatar for rezaefar 46. rezaefar Lv 1 19 pts. 10,227
  7. Avatar for borattt 47. borattt Lv 1 18 pts. 10,224
  8. Avatar for argyrw 48. argyrw Lv 1 17 pts. 10,190
  9. Avatar for Ikuso 49. Ikuso Lv 1 17 pts. 10,190
  10. Avatar for zackallen 50. zackallen Lv 1 16 pts. 10,186

Comments