Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,105
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 10,068
  3. Avatar for Australia 13. Australia 1 pt. 10,034
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,885
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,819
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 8,953
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,600
  8. Avatar for Window Group 18. Window Group 1 pt. 4,734
  1. Avatar for ucad 71. ucad Lv 1 6 pts. 10,049
  2. Avatar for kyoota 72. kyoota Lv 1 5 pts. 10,049
  3. Avatar for gdnskye 73. gdnskye Lv 1 5 pts. 10,037
  4. Avatar for Wiz kid 74. Wiz kid Lv 1 5 pts. 10,034
  5. Avatar for infjamc 75. infjamc Lv 1 5 pts. 10,026
  6. Avatar for szinr 76. szinr Lv 1 4 pts. 10,019
  7. Avatar for AlkiP0Ps 77. AlkiP0Ps Lv 1 4 pts. 10,012
  8. Avatar for Merf 78. Merf Lv 1 4 pts. 10,001
  9. Avatar for Trajan464 79. Trajan464 Lv 1 4 pts. 9,996
  10. Avatar for diamonddays 80. diamonddays Lv 1 4 pts. 9,978

Comments