Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,735
  2. Avatar for Go Science 2. Go Science 74 pts. 10,728
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,661
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,614
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,607
  6. Avatar for Contenders 6. Contenders 18 pts. 10,595
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,574
  8. Avatar for AlphaFold 8. AlphaFold 8 pts. 10,552
  9. Avatar for Kotocycle 9. Kotocycle 5 pts. 10,190
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 10,122

  1. Avatar for lightunifly 141. lightunifly Lv 1 1 pt. 8,241
  2. Avatar for Wellele12 142. Wellele12 Lv 1 1 pt. 7,819
  3. Avatar for maelizar 143. maelizar Lv 1 1 pt. 7,376
  4. Avatar for alexisjones 144. alexisjones Lv 1 1 pt. 7,350
  5. Avatar for Victorialove21 145. Victorialove21 Lv 1 1 pt. 7,298
  6. Avatar for jeher 146. jeher Lv 1 1 pt. 7,270
  7. Avatar for Sciren 147. Sciren Lv 1 1 pt. 6,734
  8. Avatar for bkoep 148. bkoep Lv 1 1 pt. 4,734
  9. Avatar for El_Muchacho 149. El_Muchacho Lv 1 1 pt. 4,734
  10. Avatar for salmacantu 150. salmacantu Lv 1 1 pt. 4,734

Comments