Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,308
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,887
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,800
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,678
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 8,211
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 0
  1. Avatar for Tonzi 111. Tonzi Lv 1 1 pt. 7,723
  2. Avatar for ManVsYard 112. ManVsYard Lv 1 1 pt. 7,712
  3. Avatar for Mikhael451 113. Mikhael451 Lv 1 1 pt. 7,690
  4. Avatar for emilymonahan 114. emilymonahan Lv 1 1 pt. 7,687
  5. Avatar for banerjeeblue13 115. banerjeeblue13 Lv 1 1 pt. 7,645
  6. Avatar for Jacob Lijoy 116. Jacob Lijoy Lv 1 1 pt. 7,639
  7. Avatar for Swapper242 117. Swapper242 Lv 1 1 pt. 7,617
  8. Avatar for ivalnic 118. ivalnic Lv 1 1 pt. 7,598
  9. Avatar for furi0us 119. furi0us Lv 1 1 pt. 7,596
  10. Avatar for bipanachundali 120. bipanachundali Lv 1 1 pt. 7,586

Comments